EREG (Human) Recombinant Protein

Catalog Number: ABN-P7894
Article Name: EREG (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7894
Supplier Catalog Number: P7894
Alternative Catalog Number: ABN-P7894-500
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human EREG (O14944, 63 a.a. - 108 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.
Tag: hIgG-His
UniProt: 2069
Buffer: In PBS, pH 7.4 (10% glycerol)
Form: Liquid
Sequence: DGSMVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
Target: EREG
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.