IL17A (Canine) Recombinant Protein, Human
Catalog Number:
ABN-P7896
| Article Name: |
IL17A (Canine) Recombinant Protein, Human |
| Biozol Catalog Number: |
ABN-P7896 |
| Supplier Catalog Number: |
P7896 |
| Alternative Catalog Number: |
ABN-P7896-50 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Canine |
| Canine IL17A (C6L8D7, 29 a.a. - 155 a.a.) partial recombinant protein with His tag expressed in HEK293 cells. |
| Tag: |
His |
| UniProt: |
481837 |
| Buffer: |
In PBS, pH 7.4 (20% glycerol) |
| Form: |
Liquid |
| Sequence: |
FPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA |
| Target: |
IL17A |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
