CD47 (Human) Recombinant Protein, Virus
Catalog Number:
ABN-P7898
| Article Name: |
CD47 (Human) Recombinant Protein, Virus |
| Biozol Catalog Number: |
ABN-P7898 |
| Supplier Catalog Number: |
P7898 |
| Alternative Catalog Number: |
ABN-P7898-50 |
| Manufacturer: |
Abnova |
| Host: |
Virus |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human CD47 (Q08722, 19 a.a. - 141 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus. |
| Tag: |
hIgG-His |
| UniProt: |
961 |
| Buffer: |
In PBS, pH 7.4 (10% glycerol) |
| Form: |
Liquid |
| Sequence: |
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNELEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE |
| Target: |
CD47 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
