EFNA5 (Human) Recombinant Protein, Virus
Catalog Number:
ABN-P7900
Article Name: |
EFNA5 (Human) Recombinant Protein, Virus |
Biozol Catalog Number: |
ABN-P7900 |
Supplier Catalog Number: |
P7900 |
Alternative Catalog Number: |
ABN-P7900-50 |
Manufacturer: |
Abnova |
Host: |
Virus |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Species Reactivity: |
Human |
Human EFNA5 (P52803, 21 a.a. - 203 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus. |
Tag: |
hIgG-His |
UniProt: |
1946 |
Buffer: |
In PBS, pH 7.4 (10% glycerol) |
Form: |
Liquid |
Sequence: |
QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH |
Target: |
EFNA5 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |