SPON1 (Human) Recombinant Protein
Catalog Number:
ABN-P7910
| Article Name: |
SPON1 (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P7910 |
| Supplier Catalog Number: |
P7910 |
| Alternative Catalog Number: |
ABN-P7910-50 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human SPON1 (Q9HCB6, 29 a.a. - 807 a.a.) partial recombinant protein with His tag expressed in HEK293 cells. |
| Tag: |
His |
| UniProt: |
10418 |
| Buffer: |
In PBS, pH 7.4 (30% glycerol) |
| Form: |
Liquid |
| Sequence: |
FSDETLDKVPKSEGYCSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREGDKEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTV |
| Target: |
SPON1 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
