IL2RG (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8255
Article Name: IL2RG (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8255
Supplier Catalog Number: P8255
Alternative Catalog Number: ABN-P8255-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: SDS-PAGE
Human IL2RG (P31785, 23 a.a. - 262 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3561
Buffer: In PBS pH 7.4
Form: Liquid
Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAHHHHHH
Target: IL2RG
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.