IL3 (Human) Recombinant Protein, Insect
Catalog Number:
ABN-P8258
| Article Name: |
IL3 (Human) Recombinant Protein, Insect |
| Biozol Catalog Number: |
ABN-P8258 |
| Supplier Catalog Number: |
P8258 |
| Alternative Catalog Number: |
ABN-P8258-2 |
| Manufacturer: |
Abnova |
| Host: |
Insect |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Human IL3 (P08700, 20 a.a. - 152 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
| Tag: |
His |
| UniProt: |
3562 |
| Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
| Form: |
Lyophilized |
| Sequence: |
APAPTTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Target: |
IL3 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
