Il3ra (Mouse) Recombinant Protein, Insect
Catalog Number:
ABN-P8265
Article Name: |
Il3ra (Mouse) Recombinant Protein, Insect |
Biozol Catalog Number: |
ABN-P8265 |
Supplier Catalog Number: |
P8265 |
Alternative Catalog Number: |
ABN-P8265-2 |
Manufacturer: |
Abnova |
Host: |
Insect |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Mouse Il3ra (P26952, 17 a.a. - 331 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
Tag: |
His |
UniProt: |
16188 |
Buffer: |
In 20mM Tris-HCl buffer pH 8.0 (0.1M NaCl, 30% glycerol) |
Form: |
Liquid |
Sequence: |
SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQ |
Target: |
Il3ra |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |