Il3ra (Mouse) Recombinant Protein, Insect
Catalog Number:
ABN-P8265
| Article Name: |
Il3ra (Mouse) Recombinant Protein, Insect |
| Biozol Catalog Number: |
ABN-P8265 |
| Supplier Catalog Number: |
P8265 |
| Alternative Catalog Number: |
ABN-P8265-2 |
| Manufacturer: |
Abnova |
| Host: |
Insect |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Mouse Il3ra (P26952, 17 a.a. - 331 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
| Tag: |
His |
| UniProt: |
16188 |
| Buffer: |
In 20mM Tris-HCl buffer pH 8.0 (0.1M NaCl, 30% glycerol) |
| Form: |
Liquid |
| Sequence: |
SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQ |
| Target: |
Il3ra |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
