IL4R (Human) Recombinant Protein, Insect
Catalog Number:
ABN-P8275
Article Name: |
IL4R (Human) Recombinant Protein, Insect |
Biozol Catalog Number: |
ABN-P8275 |
Supplier Catalog Number: |
P8275 |
Alternative Catalog Number: |
ABN-P8275-15 |
Manufacturer: |
Abnova |
Host: |
Insect |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Human IL4R (P24394, 26 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
Tag: |
His |
UniProt: |
3566 |
Buffer: |
In PBS pH 7.4 |
Form: |
Liquid |
Sequence: |
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLEHHHHHH |
Target: |
IL4R |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |