IL6 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8287
Article Name: IL6 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8287
Supplier Catalog Number: P8287
Alternative Catalog Number: ABN-P8287-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 3569
Buffer: In PBS pH 7.4
Form: Lyophilized
Sequence: MPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Target: IL6
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.