IL6 (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8289
Article Name: IL6 (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8289
Supplier Catalog Number: P8289
Alternative Catalog Number: ABN-P8289-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3569
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMHHHHHH
Target: IL6
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.