IL6ST (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8300
Article Name: IL6ST (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8300
Supplier Catalog Number: P8300
Alternative Catalog Number: ABN-P8300-5
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL6ST (Q17RA0, 23 a.a. - 619 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3572
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDRGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPED
Target: IL6ST
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.