IL7 (Human) Recombinant Protein, Yeast
Catalog Number:
ABN-P8302
| Article Name: |
IL7 (Human) Recombinant Protein, Yeast |
| Biozol Catalog Number: |
ABN-P8302 |
| Supplier Catalog Number: |
P8302 |
| Alternative Catalog Number: |
ABN-P8302-2 |
| Manufacturer: |
Abnova |
| Host: |
Yeast |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein expressed in Saccharomyces cerevisiae. |
| UniProt: |
3574 |
| Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
| Form: |
Lyophilized |
| Sequence: |
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Target: |
IL7 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
