IL7 (Human) Recombinant Protein, Yeast

Catalog Number: ABN-P8302
Article Name: IL7 (Human) Recombinant Protein, Yeast
Biozol Catalog Number: ABN-P8302
Supplier Catalog Number: P8302
Alternative Catalog Number: ABN-P8302-2
Manufacturer: Abnova
Host: Yeast
Category: Proteine/Peptide
Application: SDS-PAGE
Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein expressed in Saccharomyces cerevisiae.
UniProt: 3574
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Target: IL7
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.