IL7 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8303
Article Name: |
IL7 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P8303 |
Supplier Catalog Number: |
P8303 |
Alternative Catalog Number: |
ABN-P8303-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: |
His |
UniProt: |
3574 |
Buffer: |
In PBS pH 7.4 (50% glycerol) |
Form: |
Liquid |
Sequence: |
HHHHHHDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Target: |
IL7 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |