IL7 (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8305
Article Name: IL7 (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8305
Supplier Catalog Number: P8305
Alternative Catalog Number: ABN-P8305-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3574
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: ADPDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH
Target: IL7
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.