Il7 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P8307
Article Name: Il7 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8307
Supplier Catalog Number: P8307
Alternative Catalog Number: ABN-P8307-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Rat Il7 (P56478, 26 a.a. - 154 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 25647
Buffer: In PBS pH 7.4
Form: Lyophilized
Sequence: DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSI
Target: Il7
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.