IL9 (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8311
Article Name: IL9 (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8311
Supplier Catalog Number: P8311
Alternative Catalog Number: ABN-P8311-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL9 (P15248, 19 a.a. - 144 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3578
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTN TTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKIHHHHHH
Target: IL9
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.