Il9 (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P8312
Article Name: Il9 (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8312
Supplier Catalog Number: P8312
Alternative Catalog Number: ABN-P8312-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Mouse Il9 (P15247, 18 a.a. - 144 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 16198
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: MQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTMSFLKSLLGTFQKTEMQRQKSRP
Target: Il9
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.