IL10 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8315
Article Name: IL10 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8315
Supplier Catalog Number: P8315
Alternative Catalog Number: ABN-P8315-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human IL10 (P22301, 19 a.a. - 178 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 3586
Buffer: In 20mM Tris-HCl buffer pH 8.0 (20% glycerol)
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Target: IL10
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.