IL10 (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8316
Article Name: IL10 (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8316
Supplier Catalog Number: P8316
Alternative Catalog Number: ABN-P8316-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL10 (P22301, 19 a.a. - 178 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3586
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNHHHHHH
Target: IL10
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.