Il10 (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P8317
Article Name: Il10 (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8317
Supplier Catalog Number: P8317
Alternative Catalog Number: ABN-P8317-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Mouse Il10 (P18893, 18 a.a. - 178 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 16153
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: MISRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Target: Il10
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.