Il10 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P8318
Article Name: Il10 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8318
Supplier Catalog Number: P8318
Alternative Catalog Number: ABN-P8318-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Rat Il10 (P29456, 19 a.a. - 178 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 25325
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Target: Il10
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.