IL10RB (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8321
Article Name: IL10RB (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8321
Supplier Catalog Number: P8321
Alternative Catalog Number: ABN-P8321-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: SDS-PAGE
Human IL10RB (Q08334, 20 a.a. - 220 a.a.) partial recombinant protein with hlgG-His tag at C-terminus expressed in Sf9 cells.
Tag: hlgG-His
UniProt: 3588
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS
Target: IL10RB
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.