IL11 (Human) Recombinant Protein, Yeast

Catalog Number: ABN-P8323
Article Name: IL11 (Human) Recombinant Protein, Yeast
Biozol Catalog Number: ABN-P8323
Supplier Catalog Number: P8323
Alternative Catalog Number: ABN-P8323-2
Manufacturer: Abnova
Host: Yeast
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL11 (P20809, 23 a.a. - 199 a.a.) partial recombinant protein expressed in Pichia Pastoris.
UniProt: 3589
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Target: IL11
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.