Il11ra1 (Rat) Recombinant Protein, Insect

Catalog Number: ABN-P8325
Article Name: Il11ra1 (Rat) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8325
Supplier Catalog Number: P8325
Alternative Catalog Number: ABN-P8325-5
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: SDS-PAGE
Rat Il11ra1 (Q99MF4, 21 a.a. - 199 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 245983
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: TPCPQAWGPPGVQYGQPGRPVMLCCPGVNAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSRDEGTYVCRTLDGVFGGMVTLKLGSPPARPEVSCQAVDYENFSCTWSPGRVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQRILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLE
Target: Il11ra1
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.