Il12 (Mouse) Recombinant Protein, Insect

Product Overview

• Article Name: Il12 (Mouse) Recombinant Protein, Insect
• Biozol Catalog Number: ABN-P8333
• Supplier Catalog Number: P8333
• Alternative Catalog Number: ABN-P8333-2
• Manufacturer: Abnova
• Host: Insect
• Category: Proteine/Peptide
• Application: FA, SDS-PAGE

Product Description

Mouse Il12 (P43431, 23 a.a. - 215 a.a., P43432, 23 a.a. - 335 a.a.) partial recombinant protein with Il12a His tag at C-terminus expressed in Sf9 cells.

Product Properties

• Tag: His
• UniProt: 16159, 16160
• Buffer: In PBS pH 7.4 (10% glycerol)
• Form: Liquid
• Sequence: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRV VTINRVMGYLSSAHHHHHHMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVI
• Target: Il12a

Application Notes

• Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.