IL13 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8336
Article Name: IL13 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8336
Supplier Catalog Number: P8336
Alternative Catalog Number: ABN-P8336-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL13 (P35225, 35 a.a. - 146 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 3596
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Target: IL13
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.