IL13 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8337
| Article Name: |
IL13 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8337 |
| Supplier Catalog Number: |
P8337 |
| Alternative Catalog Number: |
ABN-P8337-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Human IL13 (P35225, 35 a.a. - 146 a.a.) partial recombinant protein with a substitution of Q for R at position 112 expressed in Escherichia coli. |
| UniProt: |
3596 |
| Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
| Form: |
Lyophilized |
| Sequence: |
SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
| Target: |
IL13 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
