Il13 (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P8339
Article Name: Il13 (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8339
Supplier Catalog Number: P8339
Alternative Catalog Number: ABN-P8339-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Mouse Il13 (P20109, 21 a.a. - 132 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
UniProt: 16163
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Target: Il13
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.