Il13 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P8341
Article Name: Il13 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8341
Supplier Catalog Number: P8341
Alternative Catalog Number: ABN-P8341-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Rat Il13 (P42203, 23 a.a. - 131 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 116553
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: VRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDITAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Target: Il13
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.