Il13 (Rat) Recombinant Protein, E. coli
Catalog Number:
ABN-P8341
Article Name: |
Il13 (Rat) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P8341 |
Supplier Catalog Number: |
P8341 |
Alternative Catalog Number: |
ABN-P8341-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Rat Il13 (P42203, 23 a.a. - 131 a.a.) partial recombinant protein expressed in Escherichia coli. |
UniProt: |
116553 |
Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
Form: |
Lyophilized |
Sequence: |
VRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDITAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH |
Target: |
Il13 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |