IL13RA1 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8343
Article Name: IL13RA1 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8343
Supplier Catalog Number: P8343
Alternative Catalog Number: ABN-P8343-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human IL13RA1 (P78552, 22 a.a. - 343 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.
Tag: His
UniProt: 3597
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: GGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVF
Target: IL13RA1
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.