IL15 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8347
Article Name: |
IL15 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P8347 |
Supplier Catalog Number: |
P8347 |
Alternative Catalog Number: |
ABN-P8347-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Human IL15 (P40933, 49 a.a. - 162 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli. |
Tag: |
His |
UniProt: |
3600 |
Buffer: |
In 20mM Tris-HCl buffer pH 8.0 (0.2mM PMSF, 10% glycerol) |
Form: |
Liquid |
Sequence: |
MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH |
Target: |
IL15 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |