Il15 (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P8348
Article Name: Il15 (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8348
Supplier Catalog Number: P8348
Alternative Catalog Number: ABN-P8348-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Mouse Il15 (P48346, 49 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
UniProt: 16168
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILH EYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
Target: Il15
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.