Il15 (Rat) Recombinant Protein, E. coli
Catalog Number:
ABN-P8349
Article Name: |
Il15 (Rat) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P8349 |
Supplier Catalog Number: |
P8349 |
Alternative Catalog Number: |
ABN-P8349-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Rat Il15 (P97604, 48 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
UniProt: |
25670 |
Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
Form: |
Lyophilized |
Sequence: |
MNWIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVIESGCKECEELEERNFTEFLQSFIHIVQMFINTS |
Target: |
Il15 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |