Il15 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P8349
Article Name: Il15 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8349
Supplier Catalog Number: P8349
Alternative Catalog Number: ABN-P8349-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Rat Il15 (P97604, 48 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
UniProt: 25670
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: MNWIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVIESGCKECEELEERNFTEFLQSFIHIVQMFINTS
Target: Il15
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.