IL15RA (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8350
Article Name: IL15RA (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8350
Supplier Catalog Number: P8350
Alternative Catalog Number: ABN-P8350-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL15RA (Q13261, 31 a.a. - 205 a.a.) partial recombinant protein with hlgG-His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3601
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: ADPITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
Target: IL15RA
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.