IL17A (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8357
| Article Name: |
IL17A (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8357 |
| Supplier Catalog Number: |
P8357 |
| Alternative Catalog Number: |
ABN-P8357-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human IL17A (Q16552, 24 a.a. - 155 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
| Tag: |
His |
| UniProt: |
3605 |
| Buffer: |
In 25mM Na-Acetate pH 4.8 (50% glycerol) |
| Form: |
Liquid |
| Sequence: |
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Target: |
IL17A |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
