IL17A (Human) Recombinant Protein, Insect
Catalog Number:
ABN-P8358
Article Name: |
IL17A (Human) Recombinant Protein, Insect |
Biozol Catalog Number: |
ABN-P8358 |
Supplier Catalog Number: |
P8358 |
Alternative Catalog Number: |
ABN-P8358-2 |
Manufacturer: |
Abnova |
Host: |
Insect |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Human IL17A (Q16552, 24 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
Tag: |
His |
UniProt: |
3605 |
Buffer: |
In 20mM PBS pH 7.4 (0.1mM PMSF, 1mM EDTA, 20% glycerol) |
Form: |
Liquid |
Sequence: |
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH |
Target: |
IL17A |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |