IL17A (Human) Recombinant Protein, Insect

Catalog Number: ABN-P8358
Article Name: IL17A (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P8358
Supplier Catalog Number: P8358
Alternative Catalog Number: ABN-P8358-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: SDS-PAGE
Human IL17A (Q16552, 24 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3605
Buffer: In 20mM PBS pH 7.4 (0.1mM PMSF, 1mM EDTA, 20% glycerol)
Form: Liquid
Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
Target: IL17A
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.