IL17A (Canine) Recombinant Protein, Mammal
Catalog Number:
ABN-P8359
Article Name: |
IL17A (Canine) Recombinant Protein, Mammal |
Biozol Catalog Number: |
ABN-P8359 |
Supplier Catalog Number: |
P8359 |
Alternative Catalog Number: |
ABN-P8359-2 |
Manufacturer: |
Abnova |
Host: |
Mammal |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Canine IL17A (C6L8D7, 29 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells. |
Tag: |
His |
UniProt: |
481837 |
Buffer: |
In PBS pH 7.4 (10% glycerol) |
Form: |
Liquid |
Sequence: |
FPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVAHHHHHH |
Target: |
IL17A |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |