IL17B (Human) Recombinant Protein, Insect
Catalog Number:
ABN-P8362
| Article Name: |
IL17B (Human) Recombinant Protein, Insect |
| Biozol Catalog Number: |
ABN-P8362 |
| Supplier Catalog Number: |
P8362 |
| Alternative Catalog Number: |
ABN-P8362-5 |
| Manufacturer: |
Abnova |
| Host: |
Insect |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human IL17B (Q9UHF5, 21 a.a. - 180 a.a.) partial recombinant protein with His-tag at C-terminus expressed in Sf9 cells. |
| Tag: |
His |
| UniProt: |
27190 |
| Buffer: |
In PBS pH 7.4 (10% glycerol) |
| Form: |
Liquid |
| Sequence: |
ADPQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIFHHHHHH |
| Target: |
IL17B |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
