IL25 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8364
Article Name: IL25 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8364
Supplier Catalog Number: P8364
Alternative Catalog Number: ABN-P8364-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL25 (Q9H293, 33 a.a. - 177 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 64806
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Target: IL25
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.