IL25 (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P8365
Article Name: IL25 (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P8365
Supplier Catalog Number: P8365
Alternative Catalog Number: ABN-P8365-2
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IL25 (Q9H293, 33 a.a. - 177 a.a.) partial recombinant protein with His-tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 64806
Buffer: In PBS pH 7.4 (20% glycerol)
Form: Liquid
Sequence: DGSYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGHHHHHH
Target: IL25
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.