ACVR1 (Human) Recombinant Protein, Virus

Catalog Number: ABN-P8379
Article Name: ACVR1 (Human) Recombinant Protein, Virus
Biozol Catalog Number: ABN-P8379
Supplier Catalog Number: P8379
Alternative Catalog Number: ABN-P8379-2
Manufacturer: Abnova
Host: Virus
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human ACVR1 (Q04771) recombinant protein with His-tag at C-terminal expressed in Baculovirus.
Tag: His tag
UniProt: 90
Buffer: Phosphate Buffered Saline (pH 7.4) and 10% glycerol
Form: Liquid
Sequence: MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLELEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL
Target: ACVR1