ACVRL1 (Human) Recombinant Protein, Virus

Catalog Number: ABN-P8380
Article Name: ACVRL1 (Human) Recombinant Protein, Virus
Biozol Catalog Number: ABN-P8380
Supplier Catalog Number: P8380
Alternative Catalog Number: ABN-P8380-2
Manufacturer: Abnova
Host: Virus
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human ACVRL1 (P37023) recombinant protein with His-tag at C-terminal expressed in Baculovirus.
Tag: His tag
UniProt: 94
Buffer: Phosphate buffered saline (pH7.4) and 10% glycerol
Form: Liquid
Sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQHHHHHH.
Target: ACVRL1