ADIPOQ (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8385
Article Name: ADIPOQ (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8385
Supplier Catalog Number: P8385
Alternative Catalog Number: ABN-P8385-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human ADIPOQ (Q15848, 108 a.a. - 244 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Tag: His tag
UniProt: 9370
Buffer: 20mM Tris-HCl buffer (pH 8.0), 10% glycerol and 0.4M Urea.
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
Target: ADIPOQ