Adipoq (Mouse) Recombinant Protein, Globular, E. coli
Catalog Number:
ABN-P8398
| Article Name: |
Adipoq (Mouse) Recombinant Protein, Globular, E. coli |
| Biozol Catalog Number: |
ABN-P8398 |
| Supplier Catalog Number: |
P8398 |
| Alternative Catalog Number: |
ABN-P8398-50 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Mouse |
| Mouse Adipoq (Q60994, 111 a.a. - 247 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli. |
| Tag: |
His tag |
| UniProt: |
11450 |
| Buffer: |
20mM Tris-HCl pH7.5, 50mM NaCl, 5mM DTT and 10% Glycerol. |
| Form: |
Liquid |
| Sequence: |
MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN. |
| Target: |
Adipoq |
