ANGPTL3 (Human) Recombinant Protein, Virus

Catalog Number: ABN-P8411
Article Name: ANGPTL3 (Human) Recombinant Protein, Virus
Biozol Catalog Number: ABN-P8411
Supplier Catalog Number: P8411
Alternative Catalog Number: ABN-P8411-2
Manufacturer: Abnova
Host: Virus
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human ANGPTL3 (Q9Y5C1, 17 a.a. - 460 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.
Tag: His tag
UniProt: 27329
Buffer: Buffered Saline (pH 7.4),30% glycerol And 1mM DTT.
Form: Liquid
Sequence: ADPSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNS
Target: ANGPTL3