APOC1 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8424
Article Name: APOC1 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8424
Supplier Catalog Number: P8424
Alternative Catalog Number: ABN-P8424-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human APOC1 Human (P02654, 27 a.a. - 83 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Tag: His-tag
UniProt: 341
Buffer: 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl and 10% glycerol
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMGSTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS.
Target: APOC1