BST2 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8496
Article Name: |
BST2 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P8496 |
Supplier Catalog Number: |
P8496 |
Alternative Catalog Number: |
ABN-P8496-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Species Reactivity: |
Human |
Human BST2 (Q10589, 50 a.a. - 161 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli. |
Tag: |
His-tag |
UniProt: |
684 |
Buffer: |
BST2 protein 0.5mg/mL is supplied in 20mM Tris-HCl, pH-8, 0.1M NaCl, 1mM DTT and 20% Glycerol. |
Form: |
Liquid |
Sequence: |
MGSSHHHHHHSSGLVPRGSHMSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS. |
Target: |
BST2 |