BST2 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8496
Article Name: BST2 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8496
Supplier Catalog Number: P8496
Alternative Catalog Number: ABN-P8496-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human BST2 (Q10589, 50 a.a. - 161 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Tag: His-tag
UniProt: 684
Buffer: BST2 protein 0.5mg/mL is supplied in 20mM Tris-HCl, pH-8, 0.1M NaCl, 1mM DTT and 20% Glycerol.
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS.
Target: BST2