BTC (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8498
Article Name: |
BTC (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P8498 |
Supplier Catalog Number: |
P8498 |
Alternative Catalog Number: |
ABN-P8498-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Species Reactivity: |
Human |
Human BTC (P35070, 32 a.a. - 111 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli. |
Tag: |
His-tag |
UniProt: |
685 |
Buffer: |
The BTC solution (0.25mg/mL) contains 20mM Tris-HCl buffer (pH 8.0), 5mM DTT, 0.2M NaCl and 20% glycerol. |
Form: |
Liquid |
Sequence: |
MGSSHHHHHHSSGLVPRGSHMDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY. |
Target: |
BTC |