BTC (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8498
Article Name: BTC (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8498
Supplier Catalog Number: P8498
Alternative Catalog Number: ABN-P8498-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human BTC (P35070, 32 a.a. - 111 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Tag: His-tag
UniProt: 685
Buffer: The BTC solution (0.25mg/mL) contains 20mM Tris-HCl buffer (pH 8.0), 5mM DTT, 0.2M NaCl and 20% glycerol.
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY.
Target: BTC