BTC (Human) Recombinant Protein

Catalog Number: ABN-P8499
Article Name: BTC (Human) Recombinant Protein
Biozol Catalog Number: ABN-P8499
Supplier Catalog Number: P8499
Alternative Catalog Number: ABN-P8499-2
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human BTC (P35070, 32 a.a. - 111 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.
Tag: His-tag
UniProt: 685
Buffer: BTC protein (0.25mg/mL) contains 10% glycerol and Phosphate-Buffered Saline (pH 7.4).
Form: Liquid
Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYHHHHHH.
Target: BTC